Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4081836..4082563 | Replicon | chromosome |
| Accession | NZ_CP110260 | ||
| Organism | Escherichia albertii strain KBSW16i | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | N6N74_RS20035 | Protein ID | WP_000547563.1 |
| Coordinates | 4081836..4082147 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N6N74_RS20040 | Protein ID | WP_000126297.1 |
| Coordinates | 4082144..4082563 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N74_RS20005 (4076978) | 4076978..4078687 | + | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
| N6N74_RS20010 (4078697) | 4078697..4079239 | + | 543 | WP_000493797.1 | formate hydrogenlyase subunit HycF | - |
| N6N74_RS20015 (4079239) | 4079239..4080006 | + | 768 | WP_000067396.1 | formate hydrogenlyase subunit HycG | - |
| N6N74_RS20020 (4080003) | 4080003..4080413 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| N6N74_RS20025 (4080406) | 4080406..4080876 | + | 471 | WP_059219259.1 | hydrogenase maturation peptidase HycI | - |
| N6N74_RS20030 (4080919) | 4080919..4081674 | + | 756 | WP_113623175.1 | hypothetical protein | - |
| N6N74_RS20035 (4081836) | 4081836..4082147 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N6N74_RS20040 (4082144) | 4082144..4082563 | + | 420 | WP_000126297.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N6N74_RS20045 (4082655) | 4082655..4083083 | - | 429 | WP_000536064.1 | hypothetical protein | - |
| N6N74_RS20050 (4083512) | 4083512..4084039 | + | 528 | WP_001078780.1 | electron transport protein HydN | - |
| N6N74_RS20055 (4084192) | 4084192..4086444 | + | 2253 | WP_044710912.1 | carbamoyltransferase HypF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T263514 WP_000547563.1 NZ_CP110260:4081836-4082147 [Escherichia albertii]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15446.45 Da Isoelectric Point: 4.4596
>AT263514 WP_000126297.1 NZ_CP110260:4082144-4082563 [Escherichia albertii]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|