Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4041903..4042149 | Replicon | chromosome |
| Accession | NZ_CP110260 | ||
| Organism | Escherichia albertii strain KBSW16i | ||
Toxin (Protein)
| Gene name | hokX | Uniprot ID | S1PD89 |
| Locus tag | N6N74_RS19810 | Protein ID | WP_000956458.1 |
| Coordinates | 4041997..4042149 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 4041903..4041955 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N74_RS19795 | 4037307..4039106 | + | 1800 | WP_113623171.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
| N6N74_RS19800 | 4039106..4040818 | + | 1713 | WP_044708375.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
| N6N74_RS19805 | 4040998..4041732 | + | 735 | WP_059214466.1 | phosphoadenosine phosphosulfate reductase | - |
| - | 4041903..4041955 | - | 53 | - | - | Antitoxin |
| N6N74_RS19810 | 4041997..4042149 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
| N6N74_RS19815 | 4042275..4043312 | - | 1038 | WP_059253936.1 | aminopeptidase | - |
| N6N74_RS19820 | 4043565..4044473 | + | 909 | WP_000372392.1 | sulfate adenylyltransferase subunit CysD | - |
| N6N74_RS19825 | 4044475..4045902 | + | 1428 | WP_054412002.1 | sulfate adenylyltransferase subunit CysN | - |
| N6N74_RS19830 | 4045902..4046507 | + | 606 | WP_024164730.1 | adenylyl-sulfate kinase | - |
| N6N74_RS19835 | 4046557..4046880 | + | 324 | WP_044711292.1 | DUF3561 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T263513 WP_000956458.1 NZ_CP110260:4041997-4042149 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT263513 NZ_CP110260:c4041955-4041903 [Escherichia albertii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|