Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 3154534..3154791 Replicon chromosome
Accession NZ_CP110260
Organism Escherichia albertii strain KBSW16i

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag N6N74_RS15560 Protein ID WP_001135738.1
Coordinates 3154639..3154791 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 3154534..3154588 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6N74_RS15540 3149764..3150759 - 996 WP_001182625.1 acyltransferase -
N6N74_RS15545 3150932..3151231 + 300 WP_000979961.1 YsaB family lipoprotein -
N6N74_RS15550 3151327..3152238 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
N6N74_RS15555 3152248..3154317 + 2070 WP_149992603.1 glycine--tRNA ligase subunit beta -
- 3154534..3154588 - 55 - - Antitoxin
N6N74_RS15560 3154639..3154791 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
N6N74_RS15565 3154768..3154839 - 72 WP_212734940.1 hypothetical protein -
N6N74_RS15570 3154979..3155191 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
N6N74_RS15575 3155474..3155764 - 291 WP_000455794.1 HTH-type transcriptional regulator -
N6N74_RS15580 3156187..3156897 + 711 WP_059254282.1 DUF3053 domain-containing protein -
N6N74_RS15585 3156950..3157924 - 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
N6N74_RS15590 3158028..3158687 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T263511 WP_001135738.1 NZ_CP110260:3154639-3154791 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT263511 NZ_CP110260:c3154588-3154534 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References