Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 2775473..2776075 Replicon chromosome
Accession NZ_CP110260
Organism Escherichia albertii strain KBSW16i

Toxin (Protein)


Gene name higB Uniprot ID S1P416
Locus tag N6N74_RS13765 Protein ID WP_000897302.1
Coordinates 2775764..2776075 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N6N74_RS13760 Protein ID WP_000356397.1
Coordinates 2775473..2775763 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6N74_RS13720 (2770872) 2770872..2771774 + 903 WP_000331386.1 formate dehydrogenase O subunit beta -
N6N74_RS13725 (2771771) 2771771..2772406 + 636 WP_000829019.1 formate dehydrogenase cytochrome b556 subunit -
N6N74_RS13730 (2772403) 2772403..2773332 + 930 WP_149992925.1 formate dehydrogenase accessory protein FdhE -
N6N74_RS13735 (2773369) 2773369..2773743 - 375 WP_044713737.1 type II toxin-antitoxin system VapC family toxin -
N6N74_RS13740 (2773743) 2773743..2773985 - 243 Protein_2676 ribbon-helix-helix domain-containing protein -
N6N74_RS13745 (2774203) 2774203..2774421 - 219 WP_001251292.1 CopG family transcriptional regulator -
N6N74_RS13750 (2774836) 2774836..2775114 - 279 WP_044710309.1 hypothetical protein -
N6N74_RS13755 (2775176) 2775176..2775388 - 213 WP_000197774.1 hypothetical protein -
N6N74_RS13760 (2775473) 2775473..2775763 - 291 WP_000356397.1 NadS family protein Antitoxin
N6N74_RS13765 (2775764) 2775764..2776075 - 312 WP_000897302.1 hypothetical protein Toxin
N6N74_RS13770 (2776304) 2776304..2777212 + 909 WP_059239594.1 alpha/beta hydrolase -
N6N74_RS13775 (2777276) 2777276..2778217 - 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
N6N74_RS13780 (2778262) 2778262..2778699 - 438 WP_000560977.1 D-aminoacyl-tRNA deacylase -
N6N74_RS13785 (2778696) 2778696..2779568 - 873 WP_000916663.1 virulence factor BrkB family protein -
N6N74_RS13790 (2779562) 2779562..2780161 - 600 WP_002460585.1 glucose-1-phosphatase -
N6N74_RS13795 (2780260) 2780260..2780691 - 432 Protein_2687 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-85)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12203.19 Da        Isoelectric Point: 9.7791

>T263510 WP_000897302.1 NZ_CP110260:c2776075-2775764 [Escherichia albertii]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW

Download         Length: 312 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10846.43 Da        Isoelectric Point: 10.8907

>AT263510 WP_000356397.1 NZ_CP110260:c2775763-2775473 [Escherichia albertii]
MDKALFERLTHSMAQMNEIIEGTRQPSRTFEVDAMKIKEIRRASGLSQSKFADLISVSVDTLRNWEQGRRSPTGPAKALL
RAIANDPQHVLQALNR

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1P416

Antitoxin

Source ID Structure

References