Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2775473..2776075 | Replicon | chromosome |
| Accession | NZ_CP110260 | ||
| Organism | Escherichia albertii strain KBSW16i | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | N6N74_RS13765 | Protein ID | WP_000897302.1 |
| Coordinates | 2775764..2776075 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N6N74_RS13760 | Protein ID | WP_000356397.1 |
| Coordinates | 2775473..2775763 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N74_RS13720 (2770872) | 2770872..2771774 | + | 903 | WP_000331386.1 | formate dehydrogenase O subunit beta | - |
| N6N74_RS13725 (2771771) | 2771771..2772406 | + | 636 | WP_000829019.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N6N74_RS13730 (2772403) | 2772403..2773332 | + | 930 | WP_149992925.1 | formate dehydrogenase accessory protein FdhE | - |
| N6N74_RS13735 (2773369) | 2773369..2773743 | - | 375 | WP_044713737.1 | type II toxin-antitoxin system VapC family toxin | - |
| N6N74_RS13740 (2773743) | 2773743..2773985 | - | 243 | Protein_2676 | ribbon-helix-helix domain-containing protein | - |
| N6N74_RS13745 (2774203) | 2774203..2774421 | - | 219 | WP_001251292.1 | CopG family transcriptional regulator | - |
| N6N74_RS13750 (2774836) | 2774836..2775114 | - | 279 | WP_044710309.1 | hypothetical protein | - |
| N6N74_RS13755 (2775176) | 2775176..2775388 | - | 213 | WP_000197774.1 | hypothetical protein | - |
| N6N74_RS13760 (2775473) | 2775473..2775763 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N6N74_RS13765 (2775764) | 2775764..2776075 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| N6N74_RS13770 (2776304) | 2776304..2777212 | + | 909 | WP_059239594.1 | alpha/beta hydrolase | - |
| N6N74_RS13775 (2777276) | 2777276..2778217 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N6N74_RS13780 (2778262) | 2778262..2778699 | - | 438 | WP_000560977.1 | D-aminoacyl-tRNA deacylase | - |
| N6N74_RS13785 (2778696) | 2778696..2779568 | - | 873 | WP_000916663.1 | virulence factor BrkB family protein | - |
| N6N74_RS13790 (2779562) | 2779562..2780161 | - | 600 | WP_002460585.1 | glucose-1-phosphatase | - |
| N6N74_RS13795 (2780260) | 2780260..2780691 | - | 432 | Protein_2687 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T263510 WP_000897302.1 NZ_CP110260:c2776075-2775764 [Escherichia albertii]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|