Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 943665..943890 Replicon chromosome
Accession NZ_CP110260
Organism Escherichia albertii strain KBSW16i

Toxin (Protein)


Gene name hokW Uniprot ID A0A7L6L988
Locus tag N6N74_RS04660 Protein ID WP_000813269.1
Coordinates 943665..943820 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 943832..943890 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6N74_RS04625 938773..939819 - 1047 WP_149992666.1 site-specific DNA-methyltransferase -
N6N74_RS04630 939970..940167 - 198 WP_097738630.1 TrmB family transcriptional regulator -
N6N74_RS04635 940454..941272 - 819 WP_097738631.1 CPBP family intramembrane metalloprotease -
N6N74_RS04640 941423..941791 - 369 WP_223274661.1 antiterminator Q family protein -
N6N74_RS04645 941784..942161 - 378 WP_149992664.1 RusA family crossover junction endodeoxyribonuclease -
N6N74_RS04650 942162..943217 - 1056 WP_149992663.1 DUF968 domain-containing protein -
N6N74_RS04655 943219..943497 - 279 WP_059274501.1 hypothetical protein -
N6N74_RS04660 943665..943820 - 156 WP_000813269.1 type I toxin-antitoxin system toxin HokD Toxin
- 943832..943890 + 59 - - Antitoxin
N6N74_RS04665 944426..945199 + 774 WP_059274496.1 alpha/beta hydrolase -
N6N74_RS04670 945555..945965 - 411 WP_262930258.1 DUF977 family protein -
N6N74_RS04675 945973..946734 - 762 WP_059274498.1 DUF1627 domain-containing protein -
N6N74_RS04680 946758..947494 - 737 Protein_919 ATP-binding protein -
N6N74_RS04685 947501..948463 - 963 WP_105210960.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - nleG7' 902230..959835 57605
- inside Prophage - nleG7' 890855..962735 71880


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5722.86 Da        Isoelectric Point: 6.1531

>T263506 WP_000813269.1 NZ_CP110260:c943820-943665 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT263506 NZ_CP110260:943832-943890 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6L988

Antitoxin

Download structure file

References