Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 943665..943890 | Replicon | chromosome |
| Accession | NZ_CP110260 | ||
| Organism | Escherichia albertii strain KBSW16i | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A7L6L988 |
| Locus tag | N6N74_RS04660 | Protein ID | WP_000813269.1 |
| Coordinates | 943665..943820 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 943832..943890 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N74_RS04625 | 938773..939819 | - | 1047 | WP_149992666.1 | site-specific DNA-methyltransferase | - |
| N6N74_RS04630 | 939970..940167 | - | 198 | WP_097738630.1 | TrmB family transcriptional regulator | - |
| N6N74_RS04635 | 940454..941272 | - | 819 | WP_097738631.1 | CPBP family intramembrane metalloprotease | - |
| N6N74_RS04640 | 941423..941791 | - | 369 | WP_223274661.1 | antiterminator Q family protein | - |
| N6N74_RS04645 | 941784..942161 | - | 378 | WP_149992664.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N6N74_RS04650 | 942162..943217 | - | 1056 | WP_149992663.1 | DUF968 domain-containing protein | - |
| N6N74_RS04655 | 943219..943497 | - | 279 | WP_059274501.1 | hypothetical protein | - |
| N6N74_RS04660 | 943665..943820 | - | 156 | WP_000813269.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 943832..943890 | + | 59 | - | - | Antitoxin |
| N6N74_RS04665 | 944426..945199 | + | 774 | WP_059274496.1 | alpha/beta hydrolase | - |
| N6N74_RS04670 | 945555..945965 | - | 411 | WP_262930258.1 | DUF977 family protein | - |
| N6N74_RS04675 | 945973..946734 | - | 762 | WP_059274498.1 | DUF1627 domain-containing protein | - |
| N6N74_RS04680 | 946758..947494 | - | 737 | Protein_919 | ATP-binding protein | - |
| N6N74_RS04685 | 947501..948463 | - | 963 | WP_105210960.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 902230..959835 | 57605 | |
| - | inside | Prophage | - | nleG7' | 890855..962735 | 71880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T263506 WP_000813269.1 NZ_CP110260:c943820-943665 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT263506 NZ_CP110260:943832-943890 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|