Detailed information of TA system TA263496

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 78466..78892
• Replicon: plasmid pKBSW50i-A
• Accession: NZ_CP110259
• Organism: Escherichia albertii strain KBSW50i

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N6N69_RS22905
• Protein ID: WP_001372321.1
• Coordinates: 78466..78591 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	78668..78892 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N6N69_RS22860 (73531)	73531..73758	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
N6N69_RS22865 (73852)	73852..74538	-	687	WP_000332495.1	PAS domain-containing protein	-
N6N69_RS22870 (74728)	74728..75111	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N6N69_RS22875 (75433)	75433..76035	+	603	WP_000243707.1	transglycosylase SLT domain-containing protein	-
N6N69_RS22880 (76331)	76331..77152	-	822	Protein_91	DUF932 domain-containing protein	-
N6N69_RS22885 (77271)	77271..77558	-	288	WP_000107542.1	hypothetical protein	-
N6N69_RS22890 (77583)	77583..77789	-	207	WP_032192990.1	hypothetical protein	-
N6N69_RS22895 (77859)	77859..77996	+	138	Protein_94	hypothetical protein	-
N6N69_RS22900 (78016)	78016..78246	-	231	WP_129954181.1	hypothetical protein	-
N6N69_RS22905 (78466)	78466..78591	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N6N69_RS22910 (78533)	78533..78682	-	150	Protein_97	plasmid maintenance protein Mok	-
- (78668)	78668..78892	-	225	NuclAT_0	-	Antitoxin
- (78668)	78668..78892	-	225	NuclAT_0	-	Antitoxin
- (78668)	78668..78892	-	225	NuclAT_0	-	Antitoxin
- (78668)	78668..78892	-	225	NuclAT_0	-	Antitoxin
N6N69_RS22915 (78704)	78704..78892	+	189	WP_001299721.1	hypothetical protein	-
N6N69_RS22920 (78861)	78861..79623	-	763	Protein_99	plasmid SOS inhibition protein A	-
N6N69_RS22925 (79620)	79620..80054	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N6N69_RS22930 (80109)	80109..82067	-	1959	WP_149505783.1	ParB/RepB/Spo0J family partition protein	-
N6N69_RS22935 (82133)	82133..82366	-	234	WP_000006030.1	DUF905 family protein	-
N6N69_RS22940 (82428)	82428..82967	-	540	WP_009426937.1	single-stranded DNA-binding protein	-
N6N69_RS22945 (82993)	82993..83199	-	207	WP_000547971.1	hypothetical protein	-
N6N69_RS22950 (83440)	83440..83685	-	246	WP_071602007.1	hypothetical protein	-
N6N69_RS22955 (83610)	83610..83840	-	231	WP_225876888.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	iutA / iucD / iucC / iucB / iucA	1..125950	125950

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T263496 WP_001372321.1 NZ_CP110259:c78591-78466 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT263496 NZ_CP110259:c78892-78668 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin