Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
Location | 3914916..3915328 | Replicon | chromosome |
Accession | NZ_CP110258 | ||
Organism | Escherichia albertii strain KBSW50i |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A8D9PK47 |
Locus tag | N6N69_RS19015 | Protein ID | WP_000132619.1 |
Coordinates | 3914987..3915328 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 3914916..3914992 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6N69_RS19005 (3911555) | 3911555..3913024 | + | 1470 | WP_016159453.1 | type I restriction-modification system subunit M | - |
N6N69_RS19010 (3913024) | 3913024..3914766 | + | 1743 | WP_103054261.1 | restriction endonuclease subunit S | - |
- (3914916) | 3914916..3914992 | - | 77 | NuclAT_6 | - | Antitoxin |
- (3914916) | 3914916..3914992 | - | 77 | NuclAT_6 | - | Antitoxin |
- (3914916) | 3914916..3914992 | - | 77 | NuclAT_6 | - | Antitoxin |
- (3914916) | 3914916..3914992 | - | 77 | NuclAT_6 | - | Antitoxin |
- (3914916) | 3914916..3914992 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3914916) | 3914916..3914992 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3914916) | 3914916..3914992 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3914916) | 3914916..3914992 | - | 77 | NuclAT_7 | - | Antitoxin |
N6N69_RS19015 (3914987) | 3914987..3915328 | + | 342 | WP_000132619.1 | endoribonuclease SymE | Toxin |
N6N69_RS19020 (3915490) | 3915490..3916869 | + | 1380 | WP_059217670.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
N6N69_RS19025 (3916869) | 3916869..3917915 | + | 1047 | WP_072252312.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
N6N69_RS19030 (3917971) | 3917971..3919049 | - | 1079 | Protein_3718 | DUF1998 domain-containing protein | - |
N6N69_RS19035 (3919364) | 3919364..3920295 | - | 932 | Protein_3719 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3907947..3926600 | 18653 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12322.13 Da Isoelectric Point: 7.8219
>T263491 WP_000132619.1 NZ_CP110258:3914987-3915328 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT263491 NZ_CP110258:c3914992-3914916 [Escherichia albertii]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|