Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2270698..2270923 | Replicon | chromosome |
| Accession | NZ_CP110258 | ||
| Organism | Escherichia albertii strain KBSW50i | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | N6N69_RS10980 | Protein ID | WP_000813254.1 |
| Coordinates | 2270768..2270923 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2270698..2270756 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N69_RS10940 | 2266246..2266401 | - | 156 | WP_000379589.1 | DUF1391 family protein | - |
| N6N69_RS10945 | 2266568..2266975 | - | 408 | WP_000379970.1 | DNA-binding transcriptional dual regulator DicA | - |
| N6N69_RS10950 | 2267059..2267289 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| N6N69_RS10955 | 2267273..2267794 | + | 522 | WP_054486275.1 | toxin YdaT family protein | - |
| N6N69_RS10960 | 2267775..2268740 | + | 966 | WP_054486274.1 | hypothetical protein | - |
| N6N69_RS10965 | 2268781..2269203 | + | 423 | WP_001151183.1 | DUF977 family protein | - |
| N6N69_RS10970 | 2269200..2269376 | + | 177 | Protein_2142 | methyltransferase | - |
| N6N69_RS10975 | 2269487..2270152 | + | 666 | WP_021568046.1 | epoxyqueuosine reductase QueH | - |
| - | 2270698..2270756 | - | 59 | - | - | Antitoxin |
| N6N69_RS10980 | 2270768..2270923 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| N6N69_RS10985 | 2271140..2271391 | + | 252 | WP_000980999.1 | protein Rem | - |
| N6N69_RS10990 | 2271458..2271736 | + | 279 | WP_023147795.1 | hypothetical protein | - |
| N6N69_RS10995 | 2271738..2272787 | + | 1050 | WP_105266918.1 | DUF968 domain-containing protein | - |
| N6N69_RS11000 | 2272801..2273553 | + | 753 | WP_001557930.1 | antitermination protein | - |
| N6N69_RS11005 | 2274714..2274899 | - | 186 | WP_000203370.1 | hypothetical protein | - |
| N6N69_RS11010 | 2275525..2275614 | - | 90 | WP_120795389.1 | hypothetical protein | - |
| N6N69_RS11015 | 2275669..2275881 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2250577..2308093 | 57516 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T263487 WP_000813254.1 NZ_CP110258:2270768-2270923 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT263487 NZ_CP110258:c2270756-2270698 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|