Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2270698..2270923 Replicon chromosome
Accession NZ_CP110258
Organism Escherichia albertii strain KBSW50i

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag N6N69_RS10980 Protein ID WP_000813254.1
Coordinates 2270768..2270923 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2270698..2270756 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6N69_RS10940 2266246..2266401 - 156 WP_000379589.1 DUF1391 family protein -
N6N69_RS10945 2266568..2266975 - 408 WP_000379970.1 DNA-binding transcriptional dual regulator DicA -
N6N69_RS10950 2267059..2267289 + 231 WP_000920568.1 dicB transcriptional regulator DicC -
N6N69_RS10955 2267273..2267794 + 522 WP_054486275.1 toxin YdaT family protein -
N6N69_RS10960 2267775..2268740 + 966 WP_054486274.1 hypothetical protein -
N6N69_RS10965 2268781..2269203 + 423 WP_001151183.1 DUF977 family protein -
N6N69_RS10970 2269200..2269376 + 177 Protein_2142 methyltransferase -
N6N69_RS10975 2269487..2270152 + 666 WP_021568046.1 epoxyqueuosine reductase QueH -
- 2270698..2270756 - 59 - - Antitoxin
N6N69_RS10980 2270768..2270923 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
N6N69_RS10985 2271140..2271391 + 252 WP_000980999.1 protein Rem -
N6N69_RS10990 2271458..2271736 + 279 WP_023147795.1 hypothetical protein -
N6N69_RS10995 2271738..2272787 + 1050 WP_105266918.1 DUF968 domain-containing protein -
N6N69_RS11000 2272801..2273553 + 753 WP_001557930.1 antitermination protein -
N6N69_RS11005 2274714..2274899 - 186 WP_000203370.1 hypothetical protein -
N6N69_RS11010 2275525..2275614 - 90 WP_120795389.1 hypothetical protein -
N6N69_RS11015 2275669..2275881 - 213 WP_000087756.1 cold shock-like protein CspF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2250577..2308093 57516


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T263487 WP_000813254.1 NZ_CP110258:2270768-2270923 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT263487 NZ_CP110258:c2270756-2270698 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References