Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 597710..598509 | Replicon | chromosome |
| Accession | NZ_CP110258 | ||
| Organism | Escherichia albertii strain KBSW50i | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
| Locus tag | N6N69_RS03005 | Protein ID | WP_059227548.1 |
| Coordinates | 597710..598174 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | N6N69_RS03010 | Protein ID | WP_103053959.1 |
| Coordinates | 598174..598509 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N69_RS02975 (592711) | 592711..593145 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| N6N69_RS02980 (593163) | 593163..594041 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N6N69_RS02985 (594031) | 594031..594810 | - | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N6N69_RS02990 (594821) | 594821..595294 | - | 474 | WP_002461030.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N6N69_RS02995 (595317) | 595317..596597 | - | 1281 | WP_262930512.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N6N69_RS03000 (596846) | 596846..597655 | + | 810 | WP_103053960.1 | aga operon transcriptional regulator AgaR | - |
| N6N69_RS03005 (597710) | 597710..598174 | - | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N6N69_RS03010 (598174) | 598174..598509 | - | 336 | WP_103053959.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N6N69_RS03015 (598658) | 598658..600229 | - | 1572 | WP_103053958.1 | galactarate dehydratase | - |
| N6N69_RS03020 (600600) | 600600..601934 | + | 1335 | WP_262930511.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N6N69_RS03025 (601950) | 601950..602720 | + | 771 | WP_059235438.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T263479 WP_059227548.1 NZ_CP110258:c598174-597710 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|