Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 166149..166406 Replicon chromosome
Accession NZ_CP110258
Organism Escherichia albertii strain KBSW50i

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag N6N69_RS00800 Protein ID WP_001135738.1
Coordinates 166254..166406 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 166149..166197 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6N69_RS00780 161378..162373 - 996 WP_105228345.1 acyltransferase -
N6N69_RS00785 162546..162845 + 300 WP_000979961.1 YsaB family lipoprotein -
N6N69_RS00790 162941..163852 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
N6N69_RS00795 163862..165931 + 2070 WP_103054034.1 glycine--tRNA ligase subunit beta -
- 166149..166197 - 49 - - Antitoxin
N6N69_RS00800 166254..166406 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
N6N69_RS00805 166383..166454 - 72 WP_212734940.1 hypothetical protein -
N6N69_RS00810 166594..166806 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
N6N69_RS00815 167089..167379 - 291 WP_059225708.1 HTH-type transcriptional regulator -
N6N69_RS00820 167802..168512 + 711 WP_002460072.1 DUF3053 domain-containing protein -
N6N69_RS00825 168565..169539 - 975 WP_059229182.1 glyoxylate/hydroxypyruvate reductase GhrB -
N6N69_RS00830 169643..170302 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T263477 WP_001135738.1 NZ_CP110258:166254-166406 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 49 bp

>AT263477 NZ_CP110258:c166197-166149 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References