Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
Location | 1435834..1436398 | Replicon | chromosome |
Accession | NZ_CP110214 | ||
Organism | Lacticaseibacillus paracasei strain ATG-E1 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A510WIJ9 |
Locus tag | OKX02_RS07290 | Protein ID | WP_016363448.1 |
Coordinates | 1436096..1436398 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | K6SLT0 |
Locus tag | OKX02_RS07285 | Protein ID | WP_003570051.1 |
Coordinates | 1435834..1436103 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKX02_RS07255 (OKX02_07255) | 1430840..1431727 | - | 888 | WP_003570041.1 | ABC transporter ATP-binding protein | - |
OKX02_RS07260 (OKX02_07260) | 1431924..1433150 | - | 1227 | WP_003570043.1 | hypothetical protein | - |
OKX02_RS07265 (OKX02_07265) | 1433348..1433752 | + | 405 | WP_003570045.1 | MerR family transcriptional regulator | - |
OKX02_RS07270 (OKX02_07270) | 1433745..1434071 | + | 327 | WP_003584272.1 | YrdB family protein | - |
OKX02_RS07275 (OKX02_07275) | 1434133..1434762 | + | 630 | WP_265013399.1 | DUF2399 domain-containing protein | - |
OKX02_RS07280 (OKX02_07280) | 1434807..1435460 | + | 654 | WP_003570049.1 | N-acetyltransferase | - |
OKX02_RS07285 (OKX02_07285) | 1435834..1436103 | + | 270 | WP_003570051.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OKX02_RS07290 (OKX02_07290) | 1436096..1436398 | + | 303 | WP_016363448.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OKX02_RS07295 (OKX02_07295) | 1436737..1436880 | + | 144 | WP_162259784.1 | hypothetical protein | - |
OKX02_RS07300 (OKX02_07300) | 1436998..1437690 | + | 693 | WP_003570055.1 | hypothetical protein | - |
OKX02_RS07305 (OKX02_07305) | 1437926..1440103 | + | 2178 | WP_003570057.1 | Tex family protein | - |
OKX02_RS07310 (OKX02_07310) | 1440528..1441085 | - | 558 | WP_003584278.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11510.33 Da Isoelectric Point: 9.8881
>T263429 WP_016363448.1 NZ_CP110214:1436096-1436398 [Lacticaseibacillus paracasei]
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELYVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLVK
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELYVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLVK
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A510WIJ9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2BRK6 |