Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4778480..4779082 | Replicon | chromosome |
Accession | NZ_CP110201 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 1104-65 |
Toxin (Protein)
Gene name | higB | Uniprot ID | C0Q3J8 |
Locus tag | OCK73_RS23330 | Protein ID | WP_001159630.1 |
Coordinates | 4778771..4779082 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OCK73_RS23325 | Protein ID | WP_000362050.1 |
Coordinates | 4778480..4778770 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCK73_RS23310 (4775973) | 4775973..4776875 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
OCK73_RS23315 (4776872) | 4776872..4777507 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
OCK73_RS23320 (4777504) | 4777504..4778433 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
OCK73_RS23325 (4778480) | 4778480..4778770 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
OCK73_RS23330 (4778771) | 4778771..4779082 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
OCK73_RS23335 (4779300) | 4779300..4780229 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
OCK73_RS23340 (4780315) | 4780315..4780626 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
OCK73_RS23345 (4780623) | 4780623..4781069 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
OCK73_RS23350 (4781084) | 4781084..4782025 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
OCK73_RS23355 (4782070) | 4782070..4782507 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
OCK73_RS23360 (4782504) | 4782504..4783376 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
OCK73_RS23365 (4783370) | 4783370..4783969 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T263427 WP_001159630.1 NZ_CP110201:c4779082-4778771 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT263427 WP_000362050.1 NZ_CP110201:c4778770-4778480 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|