Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2446116..2446638 | Replicon | chromosome |
Accession | NZ_CP110201 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 1104-65 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | OCK73_RS11940 | Protein ID | WP_000221343.1 |
Coordinates | 2446354..2446638 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | OCK73_RS11935 | Protein ID | WP_000885424.1 |
Coordinates | 2446116..2446364 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCK73_RS11910 (2441332) | 2441332..2442798 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
OCK73_RS11915 (2443606) | 2443606..2444320 | + | 715 | Protein_2330 | helix-turn-helix domain-containing protein | - |
OCK73_RS11920 (2444376) | 2444376..2445284 | - | 909 | WP_010989018.1 | hypothetical protein | - |
OCK73_RS11925 (2445427) | 2445427..2445759 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
OCK73_RS11930 (2445749) | 2445749..2445964 | - | 216 | WP_000206207.1 | hypothetical protein | - |
OCK73_RS11935 (2446116) | 2446116..2446364 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OCK73_RS11940 (2446354) | 2446354..2446638 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OCK73_RS11945 (2446809) | 2446809..2447198 | + | 390 | WP_000194089.1 | RidA family protein | - |
OCK73_RS11950 (2447250) | 2447250..2448329 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
OCK73_RS11955 (2448522) | 2448522..2449010 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OCK73_RS11960 (2449055) | 2449055..2450563 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2441335..2453420 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T263420 WP_000221343.1 NZ_CP110201:2446354-2446638 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |