Detailed information of TA system TA263409

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 36573..36842
• Replicon: plasmid pNDM-IncFII
• Accession: NZ_CP110199
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain 1104-75

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OCK70_RS24525
• Protein ID: WP_001372321.1
• Coordinates: 36717..36842 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	36573..36638 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OCK70_RS24495	32283..32810	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OCK70_RS24500	32868..33101	+	234	WP_000006003.1	DUF905 family protein	-
OCK70_RS24505	33162..35185	+	2024	Protein_44	ParB/RepB/Spo0J family partition protein	-
OCK70_RS24510	35254..35688	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OCK70_RS24515	35685..36404	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	36416..36640	+	225	NuclAT_0	-	-
-	36416..36640	+	225	NuclAT_0	-	-
-	36416..36640	+	225	NuclAT_0	-	-
-	36416..36640	+	225	NuclAT_0	-	-
-	36573..36638	-	66	-	-	Antitoxin
OCK70_RS24520	36626..36775	+	150	Protein_47	plasmid maintenance protein Mok	-
OCK70_RS24525	36717..36842	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OCK70_RS24530	37161..37457	-	297	Protein_49	hypothetical protein	-
OCK70_RS24535	37757..38053	+	297	WP_001272251.1	hypothetical protein	-
OCK70_RS24540	38164..38985	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OCK70_RS24545	39282..39872	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
OCK70_RS24550	40207..40590	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OCK70_RS24555	40784..41455	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
OCK70_RS24560	41592..41819	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T263409 WP_001372321.1 NZ_CP110199:36717-36842 [Salmonella enterica subsp. enterica serovar Typhimurium]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT263409 NZ_CP110199:c36638-36573 [Salmonella enterica subsp. enterica serovar Typhimurium]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin