Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 36416..36842 | Replicon | plasmid pNDM-IncFII |
| Accession | NZ_CP110199 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 1104-75 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OCK70_RS24525 | Protein ID | WP_001372321.1 |
| Coordinates | 36717..36842 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 36416..36640 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCK70_RS24490 (31532) | 31532..31981 | - | 450 | Protein_41 | hypothetical protein | - |
| OCK70_RS24495 (32283) | 32283..32810 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OCK70_RS24500 (32868) | 32868..33101 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| OCK70_RS24505 (33162) | 33162..35185 | + | 2024 | Protein_44 | ParB/RepB/Spo0J family partition protein | - |
| OCK70_RS24510 (35254) | 35254..35688 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OCK70_RS24515 (35685) | 35685..36404 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - (36416) | 36416..36640 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (36416) | 36416..36640 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (36416) | 36416..36640 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (36416) | 36416..36640 | + | 225 | NuclAT_0 | - | Antitoxin |
| OCK70_RS24520 (36626) | 36626..36775 | + | 150 | Protein_47 | plasmid maintenance protein Mok | - |
| OCK70_RS24525 (36717) | 36717..36842 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OCK70_RS24530 (37161) | 37161..37457 | - | 297 | Protein_49 | hypothetical protein | - |
| OCK70_RS24535 (37757) | 37757..38053 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| OCK70_RS24540 (38164) | 38164..38985 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| OCK70_RS24545 (39282) | 39282..39872 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
| OCK70_RS24550 (40207) | 40207..40590 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OCK70_RS24555 (40784) | 40784..41455 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| OCK70_RS24560 (41592) | 41592..41819 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T263408 WP_001372321.1 NZ_CP110199:36717-36842 [Salmonella enterica subsp. enterica serovar Typhimurium]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT263408 NZ_CP110199:36416-36640 [Salmonella enterica subsp. enterica serovar Typhimurium]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|