Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2445916..2446438 | Replicon | chromosome |
Accession | NZ_CP110198 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 1104-75 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | OCK70_RS11930 | Protein ID | WP_000221343.1 |
Coordinates | 2446154..2446438 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | OCK70_RS11925 | Protein ID | WP_000885424.1 |
Coordinates | 2445916..2446164 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCK70_RS11900 (2441132) | 2441132..2442598 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
OCK70_RS11905 (2443406) | 2443406..2444120 | + | 715 | Protein_2328 | helix-turn-helix domain-containing protein | - |
OCK70_RS11910 (2444176) | 2444176..2445084 | - | 909 | WP_010989018.1 | hypothetical protein | - |
OCK70_RS11915 (2445227) | 2445227..2445559 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
OCK70_RS11920 (2445549) | 2445549..2445764 | - | 216 | WP_000206207.1 | hypothetical protein | - |
OCK70_RS11925 (2445916) | 2445916..2446164 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OCK70_RS11930 (2446154) | 2446154..2446438 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OCK70_RS11935 (2446609) | 2446609..2446998 | + | 390 | WP_000194089.1 | RidA family protein | - |
OCK70_RS11940 (2447050) | 2447050..2448129 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
OCK70_RS11945 (2448322) | 2448322..2448810 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OCK70_RS11950 (2448855) | 2448855..2450363 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2441135..2453220 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T263399 WP_000221343.1 NZ_CP110198:2446154-2446438 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |