Detailed information of TA system TA263385

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 115856..116125
• Replicon: plasmid p1FK563
• Accession: NZ_CP110194
• Organism: Klebsiella pneumoniae strain FK563

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OEW01_RS26735
• Protein ID: WP_001372321.1
• Coordinates: 116000..116125 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	115856..115921 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OEW01_RS26695	110881..111150	+	270	WP_071977877.1	hypothetical protein	-
OEW01_RS26700	111391..111597	+	207	WP_000547975.1	hypothetical protein	-
OEW01_RS26705	111623..112162	+	540	WP_000290841.1	single-stranded DNA-binding protein	-
OEW01_RS26710	112225..112458	+	234	WP_000005990.1	DUF905 family protein	-
OEW01_RS26715	112524..114482	+	1959	WP_000117179.1	ParB/RepB/Spo0J family partition protein	-
OEW01_RS26720	114537..114971	+	435	WP_000845940.1	conjugation system SOS inhibitor PsiB	-
OEW01_RS26725	114968..115687	+	720	WP_001276232.1	plasmid SOS inhibition protein A	-
-	115699..115923	+	225	NuclAT_0	-	-
-	115699..115923	+	225	NuclAT_0	-	-
-	115699..115923	+	225	NuclAT_0	-	-
-	115699..115923	+	225	NuclAT_0	-	-
-	115856..115921	-	66	-	-	Antitoxin
OEW01_RS26730	115909..116058	+	150	Protein_140	plasmid maintenance protein Mok	-
OEW01_RS26735	116000..116125	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OEW01_RS26740	116345..116575	+	231	WP_001426396.1	hypothetical protein	-
OEW01_RS26745	116573..116746	-	174	Protein_143	hypothetical protein	-
OEW01_RS26750	116816..117022	+	207	WP_000275859.1	hypothetical protein	-
OEW01_RS26755	117047..117334	+	288	WP_000107535.1	hypothetical protein	-
OEW01_RS26760	117453..118274	+	822	WP_001234469.1	DUF932 domain-containing protein	-
OEW01_RS26765	118571..119173	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
OEW01_RS26770	119504..119887	+	384	WP_001151566.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OEW01_RS26775	120021..120698	+	678	WP_001348626.1	PAS domain-containing protein	-
OEW01_RS26780	120786..121013	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17	senB	1..154204	154204

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T263385 WP_001372321.1 NZ_CP110194:116000-116125 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT263385 NZ_CP110194:c115921-115856 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin