Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 115699..116125 | Replicon | plasmid p1FK563 |
| Accession | NZ_CP110194 | ||
| Organism | Klebsiella pneumoniae strain FK563 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OEW01_RS26735 | Protein ID | WP_001372321.1 |
| Coordinates | 116000..116125 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 115699..115923 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEW01_RS26690 (110756) | 110756..110980 | + | 225 | WP_264996562.1 | hypothetical protein | - |
| OEW01_RS26695 (110881) | 110881..111150 | + | 270 | WP_071977877.1 | hypothetical protein | - |
| OEW01_RS26700 (111391) | 111391..111597 | + | 207 | WP_000547975.1 | hypothetical protein | - |
| OEW01_RS26705 (111623) | 111623..112162 | + | 540 | WP_000290841.1 | single-stranded DNA-binding protein | - |
| OEW01_RS26710 (112225) | 112225..112458 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| OEW01_RS26715 (112524) | 112524..114482 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| OEW01_RS26720 (114537) | 114537..114971 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| OEW01_RS26725 (114968) | 114968..115687 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| - (115699) | 115699..115923 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (115699) | 115699..115923 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (115699) | 115699..115923 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (115699) | 115699..115923 | + | 225 | NuclAT_0 | - | Antitoxin |
| OEW01_RS26730 (115909) | 115909..116058 | + | 150 | Protein_140 | plasmid maintenance protein Mok | - |
| OEW01_RS26735 (116000) | 116000..116125 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OEW01_RS26740 (116345) | 116345..116575 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| OEW01_RS26745 (116573) | 116573..116746 | - | 174 | Protein_143 | hypothetical protein | - |
| OEW01_RS26750 (116816) | 116816..117022 | + | 207 | WP_000275859.1 | hypothetical protein | - |
| OEW01_RS26755 (117047) | 117047..117334 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| OEW01_RS26760 (117453) | 117453..118274 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| OEW01_RS26765 (118571) | 118571..119173 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| OEW01_RS26770 (119504) | 119504..119887 | + | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OEW01_RS26775 (120021) | 120021..120698 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| OEW01_RS26780 (120786) | 120786..121013 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..154204 | 154204 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T263384 WP_001372321.1 NZ_CP110194:116000-116125 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT263384 NZ_CP110194:115699-115923 [Klebsiella pneumoniae]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|