Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3924350..3924947 | Replicon | chromosome |
| Accession | NZ_CP110193 | ||
| Organism | Klebsiella pneumoniae strain FK563 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A9J6S5A1 |
| Locus tag | OEW01_RS19260 | Protein ID | WP_004893639.1 |
| Coordinates | 3924630..3924947 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | OEW01_RS19255 | Protein ID | WP_004142561.1 |
| Coordinates | 3924350..3924637 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEW01_RS19225 (3920557) | 3920557..3920805 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| OEW01_RS19230 (3920823) | 3920823..3921164 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| OEW01_RS19235 (3921195) | 3921195..3922310 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| OEW01_RS19240 (3922490) | 3922490..3923071 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| OEW01_RS19245 (3923071) | 3923071..3923439 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| OEW01_RS19250 (3923559) | 3923559..3924212 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| OEW01_RS19255 (3924350) | 3924350..3924637 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OEW01_RS19260 (3924630) | 3924630..3924947 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OEW01_RS19265 (3925132) | 3925132..3926175 | - | 1044 | WP_023279204.1 | DUF2157 domain-containing protein | - |
| OEW01_RS19270 (3926845) | 3926845..3927711 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| OEW01_RS19275 (3927820) | 3927820..3929247 | + | 1428 | WP_105910454.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3924350..3933504 | 9154 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T263373 WP_004893639.1 NZ_CP110193:c3924947-3924630 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|