Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 734841..735616 | Replicon | chromosome |
| Accession | NZ_CP110193 | ||
| Organism | Klebsiella pneumoniae strain FK563 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | OEW01_RS03650 | Protein ID | WP_004150910.1 |
| Coordinates | 735131..735616 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | OEW01_RS03645 | Protein ID | WP_004150912.1 |
| Coordinates | 734841..735134 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEW01_RS03625 (730049) | 730049..730651 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
| OEW01_RS03630 (730749) | 730749..731660 | + | 912 | WP_105910473.1 | LysR family transcriptional regulator | - |
| OEW01_RS03635 (731661) | 731661..732809 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| OEW01_RS03640 (732820) | 732820..734196 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| OEW01_RS03645 (734841) | 734841..735134 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| OEW01_RS03650 (735131) | 735131..735616 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| OEW01_RS03655 (736320) | 736320..736913 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| OEW01_RS03660 (737010) | 737010..737226 | + | 217 | Protein_719 | transposase | - |
| OEW01_RS03665 (737851) | 737851..738921 | - | 1071 | WP_045337777.1 | ParA family protein | - |
| OEW01_RS03670 (739064) | 739064..739402 | - | 339 | WP_045337778.1 | hypothetical protein | - |
| OEW01_RS03675 (739427) | 739427..739978 | - | 552 | WP_045337779.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 737010..737162 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T263366 WP_004150910.1 NZ_CP110193:735131-735616 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |