Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 356223..356869 | Replicon | chromosome |
Accession | NZ_CP110193 | ||
Organism | Klebsiella pneumoniae strain FK563 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A483JFR4 |
Locus tag | OEW01_RS01655 | Protein ID | WP_004188313.1 |
Coordinates | 356223..356570 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A483GM64 |
Locus tag | OEW01_RS01660 | Protein ID | WP_004188315.1 |
Coordinates | 356570..356869 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEW01_RS01645 (352149) | 352149..353582 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
OEW01_RS01650 (353600) | 353600..356047 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
OEW01_RS01655 (356223) | 356223..356570 | + | 348 | WP_004188313.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OEW01_RS01660 (356570) | 356570..356869 | + | 300 | WP_004188315.1 | XRE family transcriptional regulator | Antitoxin |
OEW01_RS01665 (356932) | 356932..358440 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
OEW01_RS01670 (358645) | 358645..358974 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
OEW01_RS01675 (359025) | 359025..359855 | + | 831 | WP_004188317.1 | rhomboid family intramembrane serine protease GlpG | - |
OEW01_RS01680 (359905) | 359905..360663 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13548.57 Da Isoelectric Point: 6.2327
>T263365 WP_004188313.1 NZ_CP110193:356223-356570 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483JFR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GM64 |