Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5771929..5772524 | Replicon | chromosome |
Accession | NZ_CP110190 | ||
Organism | Pseudomonas aeruginosa strain HS204 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | OMP51_RS27390 | Protein ID | WP_003113526.1 |
Coordinates | 5772246..5772524 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OMP51_RS27385 | Protein ID | WP_003113527.1 |
Coordinates | 5771929..5772234 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMP51_RS27365 (OMP51_27350) | 5767322..5767594 | - | 273 | WP_003115921.1 | hypothetical protein | - |
OMP51_RS27370 (OMP51_27355) | 5767704..5767970 | + | 267 | WP_023088595.1 | hypothetical protein | - |
OMP51_RS27375 (OMP51_27360) | 5768026..5768361 | + | 336 | WP_079862847.1 | hypothetical protein | - |
OMP51_RS27380 (OMP51_27365) | 5768476..5770935 | - | 2460 | WP_124089962.1 | SIR2 family protein | - |
OMP51_RS27385 (OMP51_27370) | 5771929..5772234 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
OMP51_RS27390 (OMP51_27375) | 5772246..5772524 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMP51_RS27395 (OMP51_27380) | 5772577..5772705 | - | 129 | Protein_5418 | integrase | - |
OMP51_RS27400 (OMP51_27385) | 5772853..5775081 | + | 2229 | WP_028680758.1 | TonB-dependent receptor | - |
OMP51_RS27405 (OMP51_27390) | 5775151..5775798 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
OMP51_RS27410 (OMP51_27395) | 5775860..5777098 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T263361 WP_003113526.1 NZ_CP110190:c5772524-5772246 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|