Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 167..800 | Replicon | chromosome |
Accession | NZ_CP110189 | ||
Organism | Vibrio cholerae strain E1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | OFY13_RS13590 | Protein ID | WP_000843587.1 |
Coordinates | 468..800 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OFY13_RS13585 | Protein ID | WP_000071010.1 |
Coordinates | 167..481 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OFY13_RS13585 (OFY13_13585) | 167..481 | - | 315 | WP_000071010.1 | DNA-binding transcriptional regulator | Antitoxin |
OFY13_RS13590 (OFY13_13590) | 468..800 | - | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OFY13_RS13595 (OFY13_13595) | 868..979 | - | 112 | Protein_3 | DUF3265 domain-containing protein | - |
OFY13_RS13600 (OFY13_13600) | 976..1719 | - | 744 | WP_000188760.1 | toll/interleukin-1 receptor domain-containing protein | - |
OFY13_RS13605 (OFY13_13605) | 1877..2824 | - | 948 | WP_000433728.1 | HEPN domain-containing protein | - |
OFY13_RS13610 (OFY13_13610) | 2961..3461 | - | 501 | WP_000686368.1 | NAD(P)H-dependent oxidoreductase | - |
OFY13_RS13615 (OFY13_13615) | 3715..3951 | + | 237 | WP_000772130.1 | RNA-binding protein | - |
OFY13_RS13620 (OFY13_13620) | 4234..5195 | + | 962 | Protein_8 | integron integrase IntIA | - |
OFY13_RS13625 (OFY13_13625) | 5277..5630 | - | 354 | WP_001138366.1 | 50S ribosomal protein L20 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | hlyA / vgrG-3 / vasL / icmF/vasK / vasJ / vasI / vasH / clpB/vasG / vasF / vasE / vasD / vasC / vasB / vasA / VCA0109 / vipB/mglB / vipA/mglA / vgrG-2 / hcp-2 / hlyA / htpB / ugd / cqsA | 44..1062811 | 1062767 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T263345 WP_000843587.1 NZ_CP110189:c800-468 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|