Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 337020..337606 Replicon chromosome
Accession NZ_CP110167
Organism Klebsiella pneumoniae strain YZ22CS094

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OK019_RS01600 Protein ID WP_002920800.1
Coordinates 337238..337606 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OK019_RS01595 Protein ID WP_004174006.1
Coordinates 337020..337241 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK019_RS01575 (333177) 333177..334103 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OK019_RS01580 (334100) 334100..335377 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OK019_RS01585 (335374) 335374..336141 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OK019_RS01590 (336143) 336143..336856 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OK019_RS01595 (337020) 337020..337241 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OK019_RS01600 (337238) 337238..337606 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OK019_RS01605 (337879) 337879..339195 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OK019_RS01610 (339302) 339302..340189 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OK019_RS01615 (340186) 340186..341031 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OK019_RS01620 (341033) 341033..342103 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 334100..342840 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T263314 WP_002920800.1 NZ_CP110167:337238-337606 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT263314 WP_004174006.1 NZ_CP110167:337020-337241 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References