Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 4021486..4022083 | Replicon | chromosome |
Accession | NZ_CP110160 | ||
Organism | Klebsiella pneumoniae strain YZ22CS089 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | OMD38_RS20150 | Protein ID | WP_004142563.1 |
Coordinates | 4021766..4022083 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | OMD38_RS20145 | Protein ID | WP_004142561.1 |
Coordinates | 4021486..4021773 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD38_RS20115 (4017566) | 4017566..4017814 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
OMD38_RS20120 (4017832) | 4017832..4018173 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
OMD38_RS20125 (4018204) | 4018204..4019319 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
OMD38_RS20130 (4019499) | 4019499..4020080 | + | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
OMD38_RS20135 (4020080) | 4020080..4020448 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
OMD38_RS20140 (4020568) | 4020568..4021221 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
OMD38_RS20145 (4021486) | 4021486..4021773 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OMD38_RS20150 (4021766) | 4021766..4022083 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMD38_RS20155 (4022268) | 4022268..4023311 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
OMD38_RS20160 (4023981) | 4023981..4024847 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
OMD38_RS20165 (4024956) | 4024956..4026383 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T263303 WP_004142563.1 NZ_CP110160:c4022083-4021766 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |