Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 4023513..4024110 | Replicon | chromosome |
Accession | NZ_CP110153 | ||
Organism | Klebsiella pneumoniae strain YZ22CS088 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | OMD36_RS20150 | Protein ID | WP_004142563.1 |
Coordinates | 4023793..4024110 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | OMD36_RS20145 | Protein ID | WP_004142561.1 |
Coordinates | 4023513..4023800 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD36_RS20115 (4019593) | 4019593..4019841 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
OMD36_RS20120 (4019859) | 4019859..4020200 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
OMD36_RS20125 (4020231) | 4020231..4021346 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
OMD36_RS20130 (4021526) | 4021526..4022107 | + | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
OMD36_RS20135 (4022107) | 4022107..4022475 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
OMD36_RS20140 (4022595) | 4022595..4023248 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
OMD36_RS20145 (4023513) | 4023513..4023800 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OMD36_RS20150 (4023793) | 4023793..4024110 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMD36_RS20155 (4024295) | 4024295..4025338 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
OMD36_RS20160 (4026008) | 4026008..4026874 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
OMD36_RS20165 (4026983) | 4026983..4028410 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T263283 WP_004142563.1 NZ_CP110153:c4024110-4023793 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |