Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 337206..337792 Replicon chromosome
Accession NZ_CP110153
Organism Klebsiella pneumoniae strain YZ22CS088

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OMD36_RS01605 Protein ID WP_002920800.1
Coordinates 337424..337792 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OMD36_RS01600 Protein ID WP_004174006.1
Coordinates 337206..337427 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD36_RS01580 (333363) 333363..334289 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OMD36_RS01585 (334286) 334286..335563 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OMD36_RS01590 (335560) 335560..336327 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OMD36_RS01595 (336329) 336329..337042 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OMD36_RS01600 (337206) 337206..337427 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OMD36_RS01605 (337424) 337424..337792 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OMD36_RS01610 (338065) 338065..339381 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OMD36_RS01615 (339488) 339488..340375 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OMD36_RS01620 (340372) 340372..341217 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OMD36_RS01625 (341219) 341219..342289 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 334286..343026 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T263275 WP_002920800.1 NZ_CP110153:337424-337792 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT263275 WP_004174006.1 NZ_CP110153:337206-337427 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References