Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 40128..40855 | Replicon | plasmid unnamed1 |
Accession | NZ_CP110151 | ||
Organism | Klebsiella pneumoniae strain YZ22CS072 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7W3D9W1 |
Locus tag | OK018_RS25540 | Protein ID | WP_011251285.1 |
Coordinates | 40128..40439 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OK018_RS25545 | Protein ID | WP_011251286.1 |
Coordinates | 40436..40855 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK018_RS25515 | 36894..37073 | - | 180 | Protein_40 | IS5/IS1182 family transposase | - |
OK018_RS25520 | 37113..38641 | - | 1529 | Protein_41 | IS66 family transposase | - |
OK018_RS25525 | 38690..39037 | - | 348 | WP_004114612.1 | IS66 family insertion sequence element accessory protein TnpB | - |
OK018_RS25530 | 39034..39372 | - | 339 | WP_023288266.1 | transposase | - |
OK018_RS25535 | 39486..39923 | + | 438 | Protein_44 | DDE-type integrase/transposase/recombinase | - |
OK018_RS25540 | 40128..40439 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
OK018_RS25545 | 40436..40855 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
OK018_RS25550 | 41002..41970 | + | 969 | WP_077268729.1 | IS5 family transposase | - |
OK018_RS25555 | 42039..42574 | - | 536 | Protein_48 | transposase | - |
OK018_RS25560 | 43099..44466 | - | 1368 | WP_032437385.1 | formimidoylglutamate deiminase | - |
OK018_RS25565 | 44569..45330 | + | 762 | WP_017900871.1 | histidine utilization repressor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(3')-Ia / blaTEM-1B / aac(3)-IId / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 | - | 1..224600 | 224600 | |
- | inside | IScluster/Tn | - | - | 32204..42433 | 10229 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T263273 WP_011251285.1 NZ_CP110151:40128-40439 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT263273 WP_011251286.1 NZ_CP110151:40436-40855 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|