Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 327723..328309 Replicon chromosome
Accession NZ_CP110148
Organism Klebsiella pneumoniae strain YZ22CS023

Toxin (Protein)


Gene name doc Uniprot ID W9BMV7
Locus tag OMA13_RS01520 Protein ID WP_004185990.1
Coordinates 327941..328309 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OMA13_RS01515 Protein ID WP_004174006.1
Coordinates 327723..327944 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMA13_RS01495 (323864) 323864..324790 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OMA13_RS01500 (324787) 324787..326064 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OMA13_RS01505 (326061) 326061..326828 + 768 WP_032435160.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OMA13_RS01510 (326846) 326846..327559 + 714 WP_086538103.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OMA13_RS01515 (327723) 327723..327944 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OMA13_RS01520 (327941) 327941..328309 + 369 WP_004185990.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OMA13_RS01525 (328582) 328582..329898 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OMA13_RS01530 (330005) 330005..330892 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OMA13_RS01535 (330889) 330889..331734 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OMA13_RS01540 (331736) 331736..332806 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 324787..333543 8756


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13469.85 Da        Isoelectric Point: 8.0667

>T263241 WP_004185990.1 NZ_CP110148:327941-328309 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVCRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT263241 WP_004174006.1 NZ_CP110148:327723-327944 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W9BMV7

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References