Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 5177126..5177712 Replicon chromosome
Accession NZ_CP110145
Organism Klebsiella pneumoniae strain YZ22CK024

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OMD35_RS25210 Protein ID WP_002920800.1
Coordinates 5177344..5177712 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OMD35_RS25205 Protein ID WP_004174006.1
Coordinates 5177126..5177347 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD35_RS25185 5173283..5174209 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OMD35_RS25190 5174206..5175483 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OMD35_RS25195 5175480..5176247 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OMD35_RS25200 5176249..5176962 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OMD35_RS25205 5177126..5177347 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OMD35_RS25210 5177344..5177712 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OMD35_RS25215 5177985..5179301 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OMD35_RS25220 5179408..5180295 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OMD35_RS25225 5180292..5181137 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OMD35_RS25230 5181139..5182209 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 5174206..5182946 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T263235 WP_002920800.1 NZ_CP110145:5177344-5177712 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT263235 WP_004174006.1 NZ_CP110145:5177126-5177347 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References