Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2486811..2487500 | Replicon | chromosome |
Accession | NZ_CP110142 | ||
Organism | Klebsiella pneumoniae strain SBH193 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | OMD37_RS12470 | Protein ID | WP_021469727.1 |
Coordinates | 2486811..2487128 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | OMD37_RS12475 | Protein ID | WP_020804705.1 |
Coordinates | 2487204..2487500 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD37_RS12440 (2482513) | 2482513..2483022 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
OMD37_RS12445 (2483032) | 2483032..2483958 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
OMD37_RS12450 (2483942) | 2483942..2484721 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
OMD37_RS12455 (2484760) | 2484760..2485611 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
OMD37_RS12460 (2485689) | 2485689..2486306 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
OMD37_RS12465 (2486377) | 2486377..2486604 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
OMD37_RS12470 (2486811) | 2486811..2487128 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMD37_RS12475 (2487204) | 2487204..2487500 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
OMD37_RS12480 (2487579) | 2487579..2488025 | + | 447 | WP_032435212.1 | hypothetical protein | - |
OMD37_RS12485 (2488066) | 2488066..2489682 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
OMD37_RS12490 (2489726) | 2489726..2491108 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T263206 WP_021469727.1 NZ_CP110142:2486811-2487128 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |