Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5302485..5303064 | Replicon | chromosome |
Accession | NZ_CP110131 | ||
Organism | Methylorubrum extorquens strain NBC_00036 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OKB92_RS25125 | Protein ID | WP_265222550.1 |
Coordinates | 5302783..5303064 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1W6RKV4 |
Locus tag | OKB92_RS25120 | Protein ID | WP_056462529.1 |
Coordinates | 5302485..5302769 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKB92_RS25100 (OKB92_25100) | 5297919..5300342 | - | 2424 | WP_265222548.1 | phenylalanine--tRNA ligase subunit beta | - |
OKB92_RS25105 (OKB92_25105) | 5300407..5301486 | - | 1080 | WP_015950513.1 | phenylalanine--tRNA ligase subunit alpha | - |
OKB92_RS25110 (OKB92_25110) | 5301670..5302035 | - | 366 | WP_003602669.1 | 50S ribosomal protein L20 | - |
OKB92_RS25115 (OKB92_25115) | 5302088..5302291 | - | 204 | WP_003602670.1 | 50S ribosomal protein L35 | - |
OKB92_RS25120 (OKB92_25120) | 5302485..5302769 | - | 285 | WP_056462529.1 | HigA family addiction module antitoxin | Antitoxin |
OKB92_RS25125 (OKB92_25125) | 5302783..5303064 | - | 282 | WP_265222550.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OKB92_RS25130 (OKB92_25130) | 5303316..5304449 | + | 1134 | WP_056111700.1 | glycosyltransferase family 4 protein | - |
OKB92_RS25135 (OKB92_25135) | 5304608..5306944 | + | 2337 | WP_056111703.1 | glycogen debranching N-terminal domain-containing protein | - |
OKB92_RS25140 (OKB92_25140) | 5307136..5307657 | - | 522 | WP_003602674.1 | translation initiation factor IF-3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10726.03 Da Isoelectric Point: 7.8895
>T263189 WP_265222550.1 NZ_CP110131:c5303064-5302783 [Methylorubrum extorquens]
MILSYRNRGTEALDVHGVCHRRWRSFQAAAGRKLDMLNAASVVSDLRSPPGNRLEKLSGDREGQWSIRINDQWRICFRWD
GSGPEDVEIVDYH
MILSYRNRGTEALDVHGVCHRRWRSFQAAAGRKLDMLNAASVVSDLRSPPGNRLEKLSGDREGQWSIRINDQWRICFRWD
GSGPEDVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|