Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67836..68100 | Replicon | plasmid p2-331_2 |
| Accession | NZ_CP110119 | ||
| Organism | Escherichia coli strain 2-331 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | OMD12_RS25355 | Protein ID | WP_001387489.1 |
| Coordinates | 67836..67988 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 68040..68100 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD12_RS25320 (63401) | 63401..63517 | + | 117 | Protein_69 | IncI1-type conjugal transfer lipoprotein TraH | - |
| OMD12_RS25325 (63516) | 63516..65270 | + | 1755 | Protein_70 | DotA/TraY family protein | - |
| OMD12_RS25330 (65341) | 65341..66003 | + | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| OMD12_RS25335 (66075) | 66075..66284 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| OMD12_RS25340 (66676) | 66676..66852 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| OMD12_RS25345 (66917) | 66917..67012 | - | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| OMD12_RS25350 (67513) | 67513..67764 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| OMD12_RS25355 (67836) | 67836..67988 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - (68040) | 68040..68100 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (68040) | 68040..68100 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (68040) | 68040..68100 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (68040) | 68040..68100 | + | 61 | NuclAT_0 | - | Antitoxin |
| OMD12_RS25360 (68309) | 68309..68683 | + | 375 | WP_223349261.1 | hypothetical protein | - |
| OMD12_RS25365 (68836) | 68836..69993 | + | 1158 | Protein_78 | IS1380-like element ISEcp1 family transposase | - |
| OMD12_RS25370 (70049) | 70049..70746 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
| OMD12_RS25375 (70757) | 70757..71065 | - | 309 | WP_039023235.1 | transcription termination/antitermination NusG family protein | - |
| OMD12_RS25380 (71507) | 71507..71794 | - | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
| OMD12_RS25385 (71832) | 71832..71990 | - | 159 | Protein_82 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-42 | - | 1..72901 | 72901 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T263154 WP_001387489.1 NZ_CP110119:c67988-67836 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT263154 NZ_CP110119:68040-68100 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|