Detailed information of TA system TA263150

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 106865..107286
• Replicon: plasmid p2-331_1
• Accession: NZ_CP110118
• Organism: Escherichia coli strain 2-331

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OMD12_RS24785
• Protein ID: WP_096937776.1
• Coordinates: 106865..106990 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	107088..107286 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OMD12_RS24745 (101929)	101929..102144	-	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-
OMD12_RS24750 (102280)	102280..102927	-	648	WP_000332520.1	conjugal transfer transcriptional regulator TraJ	-
OMD12_RS24755 (103118)	103118..103501	-	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OMD12_RS24760 (103871)	103871..104443	+	573	WP_000949660.1	transglycosylase SLT domain-containing protein	-
OMD12_RS24765 (104739)	104739..105560	-	822	WP_001234465.1	DUF932 domain-containing protein	-
OMD12_RS24770 (105679)	105679..105966	-	288	WP_000107242.1	hypothetical protein	-
OMD12_RS24775 (105991)	105991..106197	-	207	WP_000275854.1	hypothetical protein	-
OMD12_RS24780 (106267)	106267..106564	+	298	Protein_128	hypothetical protein	-
OMD12_RS24785 (106865)	106865..106990	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
OMD12_RS24790 (106932)	106932..107081	-	150	Protein_130	DUF5431 family protein	-
- (107088)	107088..107286	-	199	NuclAT_0	-	Antitoxin
- (107088)	107088..107286	-	199	NuclAT_0	-	Antitoxin
- (107088)	107088..107286	-	199	NuclAT_0	-	Antitoxin
- (107088)	107088..107286	-	199	NuclAT_0	-	Antitoxin
OMD12_RS24795 (107255)	107255..107360	-	106	Protein_131	plasmid SOS inhibition protein A	-
OMD12_RS24800 (107515)	107515..107832	+	318	Protein_132	IS110 family transposase	-
OMD12_RS24805 (108121)	108121..108372	-	252	Protein_133	iron-containing alcohol dehydrogenase	-
OMD12_RS24810 (108457)	108457..108969	-	513	WP_223350513.1	potassium channel family protein	-
OMD12_RS24820 (109850)	109850..109954	+	105	Protein_136	thiosulfate reductase cytochrome B subunit	-
OMD12_RS24825 (110200)	110200..111594	-	1395	WP_001037799.1	carbohydrate porin	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mph(A) / blaTEM-1B / rmtB / blaNDM-6 / sul1 / qacE / aadA2 / dfrA12 / tet(A)	-	1..143596	143596

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T263150 WP_096937776.1 NZ_CP110118:c106990-106865 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT263150 NZ_CP110118:c107286-107088 [Escherichia coli]
TCACACAGATTACCCGTAAACAGTCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin