Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 65611..65865 | Replicon | plasmid p2-331_1 |
| Accession | NZ_CP110118 | ||
| Organism | Escherichia coli strain 2-331 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A1D7QA06 |
| Locus tag | OMD12_RS24550 | Protein ID | WP_001367749.1 |
| Coordinates | 65611..65760 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 65804..65865 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD12_RS24520 (61634) | 61634..62035 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OMD12_RS24525 (61968) | 61968..62225 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OMD12_RS24530 (62318) | 62318..62971 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OMD12_RS24535 (63910) | 63910..64767 | - | 858 | WP_029702152.1 | incFII family plasmid replication initiator RepA | - |
| OMD12_RS24540 (64760) | 64760..64834 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| OMD12_RS24545 (65070) | 65070..65327 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| OMD12_RS24550 (65611) | 65611..65760 | - | 150 | WP_001367749.1 | Hok/Gef family protein | Toxin |
| - (65804) | 65804..65865 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (65804) | 65804..65865 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (65804) | 65804..65865 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (65804) | 65804..65865 | + | 62 | NuclAT_1 | - | Antitoxin |
| OMD12_RS24555 (66004) | 66004..66432 | - | 429 | WP_029702151.1 | hypothetical protein | - |
| OMD12_RS24560 (66645) | 66645..67214 | - | 570 | WP_029702150.1 | DUF2726 domain-containing protein | - |
| OMD12_RS24565 (67366) | 67366..67992 | - | 627 | WP_029702149.1 | NYN domain-containing protein | - |
| OMD12_RS24570 (68404) | 68404..68613 | - | 210 | WP_039023209.1 | hypothetical protein | - |
| OMD12_RS24575 (68744) | 68744..69304 | - | 561 | WP_001567328.1 | fertility inhibition protein FinO | - |
| OMD12_RS24580 (69359) | 69359..70105 | - | 747 | WP_052273601.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / blaTEM-1B / rmtB / blaNDM-6 / sul1 / qacE / aadA2 / dfrA12 / tet(A) | - | 1..143596 | 143596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5528.64 Da Isoelectric Point: 8.7678
>T263148 WP_001367749.1 NZ_CP110118:c65760-65611 [Escherichia coli]
MTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT263148 NZ_CP110118:65804-65865 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|