Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3885009..3885703 | Replicon | chromosome |
Accession | NZ_CP110117 | ||
Organism | Escherichia coli strain 2-331 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | OMD12_RS19055 | Protein ID | WP_001263489.1 |
Coordinates | 3885009..3885407 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | OMD12_RS19060 | Protein ID | WP_000554758.1 |
Coordinates | 3885410..3885703 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3880597) | 3880597..3880677 | - | 81 | NuclAT_11 | - | - |
- (3880597) | 3880597..3880677 | - | 81 | NuclAT_11 | - | - |
- (3880597) | 3880597..3880677 | - | 81 | NuclAT_11 | - | - |
- (3880597) | 3880597..3880677 | - | 81 | NuclAT_11 | - | - |
OMD12_RS19030 (3881273) | 3881273..3881731 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
OMD12_RS19035 (3881992) | 3881992..3883449 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
OMD12_RS19040 (3883506) | 3883506..3884027 | - | 522 | Protein_3730 | peptide chain release factor H | - |
OMD12_RS19045 (3884023) | 3884023..3884229 | - | 207 | Protein_3731 | RtcB family protein | - |
OMD12_RS19050 (3884547) | 3884547..3884999 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
OMD12_RS19055 (3885009) | 3885009..3885407 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
OMD12_RS19060 (3885410) | 3885410..3885703 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
OMD12_RS19065 (3885755) | 3885755..3886810 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
OMD12_RS19070 (3886881) | 3886881..3887666 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
OMD12_RS19075 (3887638) | 3887638..3889350 | + | 1713 | Protein_3737 | flagellar biosynthesis protein FlhA | - |
OMD12_RS19080 (3889574) | 3889574..3890071 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3885009..3900289 | 15280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T263142 WP_001263489.1 NZ_CP110117:c3885407-3885009 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |