Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2549777..2550415 | Replicon | chromosome |
| Accession | NZ_CP110117 | ||
| Organism | Escherichia coli strain 2-331 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
| Locus tag | OMD12_RS12355 | Protein ID | WP_001447010.1 |
| Coordinates | 2550239..2550415 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OMD12_RS12350 | Protein ID | WP_001270286.1 |
| Coordinates | 2549777..2550193 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD12_RS12330 (2544929) | 2544929..2545870 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| OMD12_RS12335 (2545871) | 2545871..2546884 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| OMD12_RS12340 (2546902) | 2546902..2548047 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| OMD12_RS12345 (2548292) | 2548292..2549698 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| OMD12_RS12350 (2549777) | 2549777..2550193 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| OMD12_RS12355 (2550239) | 2550239..2550415 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| OMD12_RS12360 (2550637) | 2550637..2550867 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| OMD12_RS12365 (2550959) | 2550959..2552920 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| OMD12_RS12370 (2552993) | 2552993..2553529 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| OMD12_RS12375 (2553621) | 2553621..2554796 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2554836..2555984 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T263140 WP_001447010.1 NZ_CP110117:c2550415-2550239 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT263140 WP_001270286.1 NZ_CP110117:c2550193-2549777 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|