Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 3109383..3109953 | Replicon | chromosome |
| Accession | NZ_CP110114 | ||
| Organism | Arthrobacter sp. YA7-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OIT41_RS14515 | Protein ID | WP_241710031.1 |
| Coordinates | 3109672..3109953 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OIT41_RS14510 | Protein ID | WP_241710030.1 |
| Coordinates | 3109383..3109685 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIT41_RS14485 (OIT41_14485) | 3105251..3105457 | + | 207 | WP_078108278.1 | hypothetical protein | - |
| OIT41_RS14490 (OIT41_14490) | 3105541..3105957 | - | 417 | WP_264636668.1 | hypothetical protein | - |
| OIT41_RS14495 (OIT41_14495) | 3106115..3107881 | - | 1767 | WP_241710027.1 | GNAT family N-acetyltransferase | - |
| OIT41_RS14500 (OIT41_14500) | 3107966..3108745 | + | 780 | WP_241710028.1 | alpha/beta hydrolase | - |
| OIT41_RS14505 (OIT41_14505) | 3108759..3109271 | - | 513 | WP_241710029.1 | DUF1877 family protein | - |
| OIT41_RS14510 (OIT41_14510) | 3109383..3109685 | - | 303 | WP_241710030.1 | HigA family addiction module antitoxin | Antitoxin |
| OIT41_RS14515 (OIT41_14515) | 3109672..3109953 | - | 282 | WP_241710031.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OIT41_RS14520 (OIT41_14520) | 3110132..3110824 | + | 693 | WP_241710032.1 | histidine phosphatase family protein | - |
| OIT41_RS14525 (OIT41_14525) | 3110848..3111402 | + | 555 | WP_241710033.1 | DUF3090 domain-containing protein | - |
| OIT41_RS14530 (OIT41_14530) | 3111402..3112169 | + | 768 | WP_241710034.1 | SCO1664 family protein | - |
| OIT41_RS14535 (OIT41_14535) | 3112400..3113140 | + | 741 | WP_241710035.1 | hypothetical protein | - |
| OIT41_RS14540 (OIT41_14540) | 3113431..3114138 | + | 708 | WP_241710036.1 | hypothetical protein | - |
| OIT41_RS14545 (OIT41_14545) | 3114254..3114715 | + | 462 | WP_241710037.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10798.20 Da Isoelectric Point: 8.0409
>T263125 WP_241710031.1 NZ_CP110114:c3109953-3109672 [Arthrobacter sp. YA7-1]
MIRSFGSKDTERLWSREHVASMDSRILRSALRKLRQVGSAESIEDLRVPPGNRLEALKGDRAGPYSIRINDQWRICFRWT
DAGPEEVEIVDYH
MIRSFGSKDTERLWSREHVASMDSRILRSALRKLRQVGSAESIEDLRVPPGNRLEALKGDRAGPYSIRINDQWRICFRWT
DAGPEEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|