Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1838413..1839071 | Replicon | chromosome |
| Accession | NZ_CP110114 | ||
| Organism | Arthrobacter sp. YA7-1 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | OIT41_RS08570 | Protein ID | WP_264637783.1 |
| Coordinates | 1838413..1838766 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | OIT41_RS08575 | Protein ID | WP_264637784.1 |
| Coordinates | 1838766..1839071 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIT41_RS08555 (OIT41_08555) | 1834679..1835767 | + | 1089 | WP_241711099.1 | IS630 family transposase | - |
| OIT41_RS08560 (OIT41_08560) | 1835754..1836746 | - | 993 | WP_264637781.1 | hypothetical protein | - |
| OIT41_RS08565 (OIT41_08565) | 1837217..1838113 | - | 897 | WP_264637782.1 | YaaC family protein | - |
| OIT41_RS08570 (OIT41_08570) | 1838413..1838766 | + | 354 | WP_264637783.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OIT41_RS08575 (OIT41_08575) | 1838766..1839071 | + | 306 | WP_264637784.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OIT41_RS08580 (OIT41_08580) | 1839619..1840506 | - | 888 | WP_264637785.1 | PIN domain-containing protein | - |
| OIT41_RS08585 (OIT41_08585) | 1840583..1841302 | + | 720 | WP_264637786.1 | hypothetical protein | - |
| OIT41_RS08590 (OIT41_08590) | 1841590..1842234 | - | 645 | WP_264637787.1 | nuclease-related domain-containing protein | - |
| OIT41_RS08595 (OIT41_08595) | 1842710..1842847 | + | 138 | WP_264637788.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1826010..1894877 | 68867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13249.11 Da Isoelectric Point: 5.6660
>T263124 WP_264637783.1 NZ_CP110114:1838413-1838766 [Arthrobacter sp. YA7-1]
VWNVDVELVESWLLGLDQDSYEQVIAALELLAERGPQLGRPLVDTVVRSRHKNMKELRPGSSGRSELRILFAFDPERHAI
LLVAGDKAGSWSKWYRTNIPIADELFDDHLRILKGGS
VWNVDVELVESWLLGLDQDSYEQVIAALELLAERGPQLGRPLVDTVVRSRHKNMKELRPGSSGRSELRILFAFDPERHAI
LLVAGDKAGSWSKWYRTNIPIADELFDDHLRILKGGS
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|