Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1324836..1325496 | Replicon | chromosome |
Accession | NZ_CP110102 | ||
Organism | Serratia marcescens strain SARVS06 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OKB57_RS06250 | Protein ID | WP_118891868.1 |
Coordinates | 1324836..1325189 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6G8TPX9 |
Locus tag | OKB57_RS06255 | Protein ID | WP_004935502.1 |
Coordinates | 1325194..1325496 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKB57_RS06230 (OKB57_06230) | 1320939..1321304 | + | 366 | WP_004935528.1 | diacylglycerol kinase | - |
OKB57_RS06235 (OKB57_06235) | 1321397..1322296 | + | 900 | WP_075686404.1 | LysR family transcriptional regulator | - |
OKB57_RS06240 (OKB57_06240) | 1322271..1323077 | - | 807 | WP_118891867.1 | substrate-binding domain-containing protein | - |
OKB57_RS06245 (OKB57_06245) | 1323104..1324399 | - | 1296 | WP_004935508.1 | MFS transporter | - |
OKB57_RS06250 (OKB57_06250) | 1324836..1325189 | + | 354 | WP_118891868.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OKB57_RS06255 (OKB57_06255) | 1325194..1325496 | + | 303 | WP_004935502.1 | XRE family transcriptional regulator | Antitoxin |
OKB57_RS06260 (OKB57_06260) | 1325619..1326527 | - | 909 | WP_004935498.1 | LysR family transcriptional regulator | - |
OKB57_RS06265 (OKB57_06265) | 1326666..1327586 | + | 921 | WP_031300707.1 | alpha/beta hydrolase | - |
OKB57_RS06270 (OKB57_06270) | 1327586..1328521 | + | 936 | WP_088381766.1 | alpha/beta hydrolase | - |
OKB57_RS06275 (OKB57_06275) | 1328537..1329172 | + | 636 | WP_015378474.1 | SDR family oxidoreductase | - |
OKB57_RS06280 (OKB57_06280) | 1329215..1329943 | + | 729 | WP_226882923.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1315913..1332700 | 16787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13575.59 Da Isoelectric Point: 9.0493
>T263110 WP_118891868.1 NZ_CP110102:1324836-1325189 [Serratia marcescens]
VWEIKTTDAFDHWLRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
VWEIKTTDAFDHWLRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|