Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 574024..574676 | Replicon | chromosome |
Accession | NZ_CP110102 | ||
Organism | Serratia marcescens strain SARVS06 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OKB57_RS02750 | Protein ID | WP_004931830.1 |
Coordinates | 574332..574676 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A086GAN0 |
Locus tag | OKB57_RS02745 | Protein ID | WP_004931828.1 |
Coordinates | 574024..574326 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKB57_RS02720 (OKB57_02720) | 569031..569678 | - | 648 | WP_015378930.1 | DsbA family protein | - |
OKB57_RS02725 (OKB57_02725) | 569747..570631 | - | 885 | WP_004931820.1 | MBL fold metallo-hydrolase | - |
OKB57_RS02730 (OKB57_02730) | 570740..571648 | + | 909 | WP_015378928.1 | LysR family transcriptional regulator | - |
OKB57_RS02735 (OKB57_02735) | 571676..572599 | - | 924 | WP_099982443.1 | LysR family transcriptional regulator | - |
OKB57_RS02740 (OKB57_02740) | 572734..573996 | + | 1263 | WP_004931826.1 | diaminopimelate decarboxylase | - |
OKB57_RS02745 (OKB57_02745) | 574024..574326 | - | 303 | WP_004931828.1 | XRE family transcriptional regulator | Antitoxin |
OKB57_RS02750 (OKB57_02750) | 574332..574676 | - | 345 | WP_004931830.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OKB57_RS02755 (OKB57_02755) | 574836..575855 | - | 1020 | WP_004931832.1 | HTH-type transcriptional regulator GalR | - |
OKB57_RS02760 (OKB57_02760) | 576077..578334 | + | 2258 | Protein_539 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13383.44 Da Isoelectric Point: 10.6087
>T263108 WP_004931830.1 NZ_CP110102:c574676-574332 [Serratia marcescens]
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|