Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4454137..4454788 | Replicon | chromosome |
| Accession | NZ_CP110080 | ||
| Organism | Buttiauxella sp. WJP83 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OH773_RS20560 | Protein ID | WP_270145988.1 |
| Coordinates | 4454137..4454487 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OH773_RS20565 | Protein ID | WP_270141475.1 |
| Coordinates | 4454489..4454788 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH773_RS20540 (OH773_20540) | 4449286..4450041 | - | 756 | WP_183273132.1 | bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE | - |
| OH773_RS20545 (OH773_20545) | 4450134..4451543 | - | 1410 | WP_270141471.1 | DNA recombination protein RmuC | - |
| OH773_RS20550 (OH773_20550) | 4451678..4452439 | - | 762 | WP_183273130.1 | uridine phosphorylase | - |
| OH773_RS20555 (OH773_20555) | 4452677..4453504 | + | 828 | WP_270141473.1 | dienelactone hydrolase family protein | - |
| OH773_RS20560 (OH773_20560) | 4454137..4454487 | + | 351 | WP_270145988.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OH773_RS20565 (OH773_20565) | 4454489..4454788 | + | 300 | WP_270141475.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OH773_RS20570 (OH773_20570) | 4454829..4457090 | - | 2262 | WP_270141477.1 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
| OH773_RS20575 (OH773_20575) | 4457210..4458163 | + | 954 | WP_270141479.1 | HTH-type transcriptional regulator MetR | - |
| OH773_RS20580 (OH773_20580) | 4458051..4458950 | - | 900 | WP_270141482.1 | carboxylate/amino acid/amine transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13299.40 Da Isoelectric Point: 6.2252
>T263095 WP_270145988.1 NZ_CP110080:4454137-4454487 [Buttiauxella sp. WJP83]
MWEVITTDVFDRWFLAQANALREDVLAVMGILEEMGPQLGRPYVDTLNGSAFPNMKELRIQHAGVPVRAFFAFDPVRRAI
VLCAGDKTGLNEKQFYRDMIRLAESEYCKHLAHLEK
MWEVITTDVFDRWFLAQANALREDVLAVMGILEEMGPQLGRPYVDTLNGSAFPNMKELRIQHAGVPVRAFFAFDPVRRAI
VLCAGDKTGLNEKQFYRDMIRLAESEYCKHLAHLEK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|