Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1583896..1584542 | Replicon | chromosome |
Accession | NZ_CP110080 | ||
Organism | Buttiauxella sp. WJP83 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OH773_RS07335 | Protein ID | WP_270144388.1 |
Coordinates | 1583896..1584249 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OH773_RS07340 | Protein ID | WP_270144389.1 |
Coordinates | 1584246..1584542 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH773_RS07325 (OH773_07325) | 1579168..1582302 | - | 3135 | WP_270144385.1 | MdtB/MuxB family multidrug efflux RND transporter permease subunit | - |
OH773_RS07330 (OH773_07330) | 1582302..1583540 | - | 1239 | WP_270144387.1 | MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit | - |
OH773_RS07335 (OH773_07335) | 1583896..1584249 | + | 354 | WP_270144388.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH773_RS07340 (OH773_07340) | 1584246..1584542 | + | 297 | WP_270144389.1 | XRE family transcriptional regulator | Antitoxin |
OH773_RS07345 (OH773_07345) | 1584575..1585933 | - | 1359 | WP_270144390.1 | molecular chaperone | - |
OH773_RS07350 (OH773_07350) | 1586055..1586945 | + | 891 | WP_270144392.1 | DNA-3-methyladenine glycosylase 2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13870.99 Da Isoelectric Point: 8.6754
>T263086 WP_270144388.1 NZ_CP110080:1583896-1584249 [Buttiauxella sp. WJP83]
MAWTVIYTDDFYCWYNEQPLDLRKRIVAMTLNISVWGPQLGRPLADTVKGSRFTNMKELRVQWCGKPYRLFFAFDPLQRA
VVLCGGDKTGRKRFYGDLIRLADTQFSRYLDEMERDE
MAWTVIYTDDFYCWYNEQPLDLRKRIVAMTLNISVWGPQLGRPLADTVKGSRFTNMKELRVQWCGKPYRLFFAFDPLQRA
VVLCGGDKTGRKRFYGDLIRLADTQFSRYLDEMERDE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|