Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2788843..2789109 | Replicon | chromosome |
Accession | NZ_CP110074 | ||
Organism | Enterococcus faecalis strain BE5 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OLM06_RS13785 | Protein ID | WP_002411240.1 |
Coordinates | 2788843..2788992 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2788925..2789109 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM06_RS13765 | 2783964..2784179 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
OLM06_RS13770 | 2784318..2785310 | + | 993 | WP_002389493.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
OLM06_RS13775 | 2785574..2786212 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
OLM06_RS13780 | 2786898..2788514 | + | 1617 | WP_002389442.1 | phosphatase PAP2/LCP family protein | - |
OLM06_RS13785 | 2788843..2788992 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 2788925..2789109 | - | 185 | - | - | Antitoxin |
OLM06_RS13790 | 2789111..2789251 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
OLM06_RS13795 | 2789482..2789625 | + | 144 | WP_002381035.1 | putative holin-like toxin | - |
OLM06_RS13800 | 2789820..2793647 | - | 3828 | WP_010816211.1 | WxL domain-containing protein | - |
OLM06_RS13805 | 2793634..2793996 | - | 363 | WP_002378868.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5738.05 Da Isoelectric Point: 11.3858
>T263070 WP_002411240.1 NZ_CP110074:2788843-2788992 [Enterococcus faecalis]
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 150 bp
Antitoxin
Download Length: 185 bp
>AT263070 NZ_CP110074:c2789109-2788925 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|