Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2715984..2716246 | Replicon | chromosome |
Accession | NZ_CP110074 | ||
Organism | Enterococcus faecalis strain BE5 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OLM06_RS13455 | Protein ID | WP_002367458.1 |
Coordinates | 2716103..2716246 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2715984..2716170 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM06_RS13440 | 2711441..2714185 | + | 2745 | WP_264563347.1 | glycosyl hydrolase family 65 protein | - |
OLM06_RS13445 | 2714200..2714850 | + | 651 | WP_002389419.1 | beta-phosphoglucomutase | - |
OLM06_RS13450 | 2715270..2715863 | + | 594 | WP_002389391.1 | PBECR4 domain-containing protein | - |
- | 2715984..2716170 | + | 187 | - | - | Antitoxin |
OLM06_RS13455 | 2716103..2716246 | - | 144 | WP_002367458.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
OLM06_RS13460 | 2716478..2717449 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
OLM06_RS13465 | 2717624..2718061 | - | 438 | WP_002389480.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
OLM06_RS13470 | 2718194..2718748 | - | 555 | WP_002354869.1 | Maf family protein | - |
OLM06_RS13475 | 2718773..2720905 | - | 2133 | WP_002389406.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5311.50 Da Isoelectric Point: 10.8331
>T263067 WP_002367458.1 NZ_CP110074:c2716246-2716103 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 187 bp
>AT263067 NZ_CP110074:2715984-2716170 [Enterococcus faecalis]
TGTGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGATGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA
TGTGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGATGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|