Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2803499..2803694 | Replicon | chromosome |
Accession | NZ_CP110072 | ||
Organism | Enterococcus faecalis strain BE7 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLL88_RS13595 | Protein ID | WP_015543884.1 |
Coordinates | 2803499..2803594 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2803629..2803694 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL88_RS13575 | 2798676..2799791 | + | 1116 | WP_002377910.1 | FAD-dependent oxidoreductase | - |
OLL88_RS13580 | 2799860..2801014 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OLL88_RS13585 | 2801029..2801466 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OLL88_RS13590 | 2801481..2803253 | - | 1773 | WP_002391520.1 | PTS mannitol-specific transporter subunit IIBC | - |
OLL88_RS13595 | 2803499..2803594 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2803629..2803694 | - | 66 | - | - | Antitoxin |
OLL88_RS13600 | 2803852..2804286 | - | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
OLL88_RS13605 | 2804297..2806330 | - | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
OLL88_RS13610 | 2806321..2808063 | - | 1743 | WP_002401739.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T263054 WP_015543884.1 NZ_CP110072:2803499-2803594 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT263054 NZ_CP110072:c2803694-2803629 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|