Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 2711347..2711881 Replicon chromosome
Accession NZ_CP110072
Organism Enterococcus faecalis strain BE7

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag OLL88_RS13110 Protein ID WP_002360769.1
Coordinates 2711347..2711622 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag OLL88_RS13115 Protein ID WP_002369771.1
Coordinates 2711615..2711881 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL88_RS13080 (2706519) 2706519..2706704 - 186 WP_002358660.1 hypothetical protein -
OLL88_RS13085 (2706734) 2706734..2707063 + 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
OLL88_RS13090 (2707191) 2707191..2708129 + 939 WP_002370935.1 2-dehydropantoate 2-reductase -
OLL88_RS13095 (2708155) 2708155..2709192 + 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
OLL88_RS13100 (2709497) 2709497..2710391 - 895 Protein_2567 IS256 family transposase -
OLL88_RS13105 (2710512) 2710512..2711156 + 645 WP_002377952.1 IS6 family transposase -
OLL88_RS13110 (2711347) 2711347..2711622 - 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
OLL88_RS13115 (2711615) 2711615..2711881 - 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OLL88_RS13120 (2711992) 2711992..2712576 - 585 WP_002377949.1 thermonuclease family protein -
OLL88_RS13125 (2712600) 2712600..2713016 - 417 WP_010710134.1 single-stranded DNA-binding protein -
OLL88_RS13130 (2713092) 2713092..2713340 - 249 WP_002360773.1 DUF3850 domain-containing protein -
OLL88_RS13135 (2713353) 2713353..2713853 - 501 WP_002360775.1 DnaJ domain-containing protein -
OLL88_RS13140 (2713886) 2713886..2714152 - 267 WP_002377947.1 hypothetical protein -
OLL88_RS13145 (2714744) 2714744..2715232 - 489 WP_010710133.1 hypothetical protein -
OLL88_RS13150 (2715238) 2715238..2715831 - 594 WP_002414802.1 replication-relaxation family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - esp / cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 / bsh 2667741..2731490 63749


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T263053 WP_002360769.1 NZ_CP110072:c2711622-2711347 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT263053 WP_002369771.1 NZ_CP110072:c2711881-2711615 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References