Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 259620..259956 | Replicon | chromosome |
| Accession | NZ_CP110072 | ||
| Organism | Enterococcus faecalis strain BE7 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A1J6YG70 |
| Locus tag | OLL88_RS01220 | Protein ID | WP_002396786.1 |
| Coordinates | 259813..259956 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 259620..259669 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL88_RS01215 | 254927..259618 | + | 4692 | WP_002378865.1 | WxL domain-containing protein | - |
| - | 259620..259669 | - | 50 | - | - | Antitoxin |
| OLL88_RS01220 | 259813..259956 | - | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
| OLL88_RS01225 | 260288..261904 | - | 1617 | WP_002378864.1 | phosphatase PAP2/LCP family protein | - |
| OLL88_RS01230 | 262589..263227 | + | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| OLL88_RS01235 | 263394..264386 | - | 993 | WP_002378862.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| OLL88_RS01240 | 264525..264740 | + | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T263042 WP_002396786.1 NZ_CP110072:c259956-259813 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT263042 NZ_CP110072:c259669-259620 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|