Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) fst-RNAII/-
Location 2719563..2719758 Replicon chromosome
Accession NZ_CP110071
Organism Enterococcus faecalis strain BE8

Toxin (Protein)


Gene name fst Uniprot ID -
Locus tag OLL94_RS12975 Protein ID WP_015543884.1
Coordinates 2719563..2719658 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name RNAII
Locus tag -
Coordinates 2719693..2719758 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL94_RS12955 2714740..2715855 + 1116 WP_002377910.1 FAD-dependent oxidoreductase -
OLL94_RS12955 2714740..2715855 + 1116 WP_002377910.1 FAD-dependent oxidoreductase -
OLL94_RS12955 2714740..2715855 + 1116 WP_002377910.1 FAD-dependent oxidoreductase -
OLL94_RS12960 2715924..2717078 - 1155 WP_002355280.1 mannitol-1-phosphate 5-dehydrogenase -
OLL94_RS12960 2715924..2717078 - 1155 WP_002355280.1 mannitol-1-phosphate 5-dehydrogenase -
OLL94_RS12960 2715924..2717078 - 1155 WP_002355280.1 mannitol-1-phosphate 5-dehydrogenase -
OLL94_RS12965 2717093..2717530 - 438 WP_002355279.1 PTS sugar transporter subunit IIA -
OLL94_RS12965 2717093..2717530 - 438 WP_002355279.1 PTS sugar transporter subunit IIA -
OLL94_RS12965 2717093..2717530 - 438 WP_002355279.1 PTS sugar transporter subunit IIA -
OLL94_RS12970 2717545..2719317 - 1773 WP_002391520.1 PTS mannitol-specific transporter subunit IIBC -
OLL94_RS12970 2717545..2719317 - 1773 WP_002391520.1 PTS mannitol-specific transporter subunit IIBC -
OLL94_RS12970 2717545..2719317 - 1773 WP_002391520.1 PTS mannitol-specific transporter subunit IIBC -
OLL94_RS12975 2719563..2719658 + 96 WP_015543884.1 type I toxin-antitoxin system Fst family toxin Toxin
OLL94_RS12975 2719563..2719658 + 96 WP_015543884.1 type I toxin-antitoxin system Fst family toxin Toxin
OLL94_RS12975 2719563..2719658 + 96 WP_015543884.1 type I toxin-antitoxin system Fst family toxin Toxin
- 2719693..2719758 - 66 - - Antitoxin
OLL94_RS12980 2719916..2720350 - 435 WP_002355276.1 PTS sugar transporter subunit IIA -
OLL94_RS12980 2719916..2720350 - 435 WP_002355276.1 PTS sugar transporter subunit IIA -
OLL94_RS12980 2719916..2720350 - 435 WP_002355276.1 PTS sugar transporter subunit IIA -
OLL94_RS12985 2720361..2722394 - 2034 WP_002355275.1 BglG family transcription antiterminator -
OLL94_RS12985 2720361..2722394 - 2034 WP_002355275.1 BglG family transcription antiterminator -
OLL94_RS12985 2720361..2722394 - 2034 WP_002355275.1 BglG family transcription antiterminator -
OLL94_RS12990 2722385..2724127 - 1743 WP_002401739.1 PTS transporter subunit EIIC -
OLL94_RS12990 2722385..2724127 - 1743 WP_002401739.1 PTS transporter subunit EIIC -
OLL94_RS12990 2722385..2724127 - 1743 WP_002401739.1 PTS transporter subunit EIIC -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin


No domain identified.



Sequences


Toxin        


Download         Length: 32 a.a.        Molecular weight: 3659.47 Da        Isoelectric Point: 4.6275

>T263039 WP_015543884.1 NZ_CP110071:2719563-2719658 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE

Download         Length: 96 bp


Antitoxin


Download         Length: 66 bp

>AT263039 NZ_CP110071:c2719758-2719693 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References