263038

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 2627411..2627945 Replicon chromosome
Accession NZ_CP110071
Organism Enterococcus faecalis strain BE8

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag OLL94_RS12490 Protein ID WP_002360769.1
Coordinates 2627411..2627686 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag OLL94_RS12495 Protein ID WP_002369771.1
Coordinates 2627679..2627945 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL94_RS12460 (2622583) 2622583..2622768 - 186 WP_002358660.1 hypothetical protein -
OLL94_RS12465 (2622798) 2622798..2623127 + 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
OLL94_RS12470 (2623255) 2623255..2624193 + 939 WP_002370935.1 2-dehydropantoate 2-reductase -
OLL94_RS12475 (2624219) 2624219..2625256 + 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
OLL94_RS12480 (2625561) 2625561..2626455 - 895 Protein_2447 IS256 family transposase -
OLL94_RS12485 (2626576) 2626576..2627220 + 645 WP_002377952.1 IS6 family transposase -
OLL94_RS12490 (2627411) 2627411..2627686 - 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
OLL94_RS12495 (2627679) 2627679..2627945 - 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OLL94_RS12500 (2628056) 2628056..2628640 - 585 WP_002377949.1 thermonuclease family protein -
OLL94_RS12505 (2628664) 2628664..2629080 - 417 WP_010710134.1 single-stranded DNA-binding protein -
OLL94_RS12510 (2629156) 2629156..2629404 - 249 WP_002360773.1 DUF3850 domain-containing protein -
OLL94_RS12515 (2629417) 2629417..2629917 - 501 WP_002360775.1 DnaJ domain-containing protein -
OLL94_RS12520 (2629950) 2629950..2630216 - 267 WP_002377947.1 hypothetical protein -
OLL94_RS12525 (2630808) 2630808..2631296 - 489 WP_010710133.1 hypothetical protein -
OLL94_RS12530 (2631302) 2631302..2631895 - 594 WP_002414802.1 replication-relaxation family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - esp / cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 / bsh 2583805..2647554 63749


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T263038 WP_002360769.1 NZ_CP110071:c2627686-2627411 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT263038 WP_002369771.1 NZ_CP110071:c2627945-2627679 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References