Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-DinJ |
Location | 2627411..2627945 | Replicon | chromosome |
Accession | NZ_CP110071 | ||
Organism | Enterococcus faecalis strain BE8 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R3JX52 |
Locus tag | OLL94_RS12490 | Protein ID | WP_002360769.1 |
Coordinates | 2627411..2627686 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | R3H6P0 |
Locus tag | OLL94_RS12495 | Protein ID | WP_002369771.1 |
Coordinates | 2627679..2627945 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL94_RS12460 (2622583) | 2622583..2622768 | - | 186 | WP_002358660.1 | hypothetical protein | - |
OLL94_RS12465 (2622798) | 2622798..2623127 | + | 330 | WP_002358661.1 | LPXTG cell wall anchor domain-containing protein | - |
OLL94_RS12470 (2623255) | 2623255..2624193 | + | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
OLL94_RS12475 (2624219) | 2624219..2625256 | + | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
OLL94_RS12480 (2625561) | 2625561..2626455 | - | 895 | Protein_2447 | IS256 family transposase | - |
OLL94_RS12485 (2626576) | 2626576..2627220 | + | 645 | WP_002377952.1 | IS6 family transposase | - |
OLL94_RS12490 (2627411) | 2627411..2627686 | - | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OLL94_RS12495 (2627679) | 2627679..2627945 | - | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OLL94_RS12500 (2628056) | 2628056..2628640 | - | 585 | WP_002377949.1 | thermonuclease family protein | - |
OLL94_RS12505 (2628664) | 2628664..2629080 | - | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
OLL94_RS12510 (2629156) | 2629156..2629404 | - | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
OLL94_RS12515 (2629417) | 2629417..2629917 | - | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
OLL94_RS12520 (2629950) | 2629950..2630216 | - | 267 | WP_002377947.1 | hypothetical protein | - |
OLL94_RS12525 (2630808) | 2630808..2631296 | - | 489 | WP_010710133.1 | hypothetical protein | - |
OLL94_RS12530 (2631302) | 2631302..2631895 | - | 594 | WP_002414802.1 | replication-relaxation family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integrative and Conjugative Element | - | esp / cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 / bsh | 2583805..2647554 | 63749 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10732.58 Da Isoelectric Point: 9.6918
>T263038 WP_002360769.1 NZ_CP110071:c2627686-2627411 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AEA7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AED7 |